Loading...
Statistics
Advertisement

À岩
www.3gren.cn/

3gren.cn

Advertisement
Conversion Technology Metas Server
3gren.cn is hosted in China / Shanghai . 3gren.cn doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Iframe, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Nginx.

Technologies in use by 3gren.cn

Technology

Number of occurences: 4
  • CSS
  • Html
  • Iframe
  • Swf Object

Advertisement

Server Type

  • Nginx

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - 3gren.cn

Missing HTTPS protocol.

    Meta - 3gren.cn

    Number of occurences: 1
    • Name:
      Content: text/html; charset=gb2312

    Server / Hosting

    • IP: 222.73.144.185
    • Latitude: 31.05
    • Longitude: 121.40
    • Country: China
    • City: Shanghai

    Rname

    • ns2.360wzb.com
    • ns1.360wzb.com

    Target

    • domainadmin.360wzb.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: Nginx Date: Wed, 20 Apr 2016 01:41:49 GMT Content-Type: text/html Connection: keep-alive X-Powered-By-360WZB: wangzhan.360.cn Content-Location: http://3gren.cn/index.html Last-Modified: Fri, 26 Feb 2016 05:00:40 GMT Accept-Ranges: bytes ETag: "894872a35270d11:567" X-Powered-By: ASP.NET

    DNS

    host: 3gren.cn
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 222.73.144.185
    host: 3gren.cn
    1. class: IN
    2. ttl: 6000
    3. type: NS
    4. target: ns2.360wzb.com
    host: 3gren.cn
    1. class: IN
    2. ttl: 6000
    3. type: NS
    4. target: ns1.360wzb.com
    host: 3gren.cn
    1. class: IN
    2. ttl: 180
    3. type: SOA
    4. mname: ns1.360wzb.com
    5. rname: domainadmin.360wzb.com
    6. serial: 1459251185
    7. refresh: 3600
    8. retry: 600
    9. expire: 86400
    10. minimum-ttl: 180

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.gren.cn, www.3qgren.cn, www.qgren.cn, www.3wgren.cn, www.wgren.cn, www.3egren.cn, www.egren.cn, www.3gren.cn, www.gren.cn, www.31gren.cn, www.1gren.cn, www.3ren.cn, www.3gsren.cn, www.3sren.cn, www.3gxren.cn, www.3xren.cn, www.3gyren.cn, www.3yren.cn, www.3ghren.cn, www.3hren.cn, www.3gnren.cn, www.3nren.cn, www.3gcren.cn, www.3cren.cn, www.3gdren.cn, www.3dren.cn, www.3geren.cn, www.3eren.cn, www.3grren.cn, www.3rren.cn, www.3gtren.cn, www.3tren.cn, www.3gbren.cn, www.3bren.cn, www.3gvren.cn, www.3vren.cn, www.3gen.cn, www.3grien.cn, www.3gien.cn, www.3groen.cn, www.3goen.cn, www.3grlen.cn, www.3glen.cn, www.3grlen.cn, www.3glen.cn, www.3gr.en.cn, www.3g.en.cn, www.3grn.cn, www.3grexn.cn, www.3grxn.cn, www.3gresn.cn, www.3grsn.cn, www.3grewn.cn, www.3grwn.cn, www.3grern.cn, www.3grrn.cn, www.3grefn.cn, www.3grfn.cn, www.3grevn.cn, www.3grvn.cn, www.3grecn.cn, www.3grcn.cn, www.3greqn.cn, www.3grqn.cn, www.3grean.cn, www.3gran.cn, www.3greyn.cn, www.3gryn.cn, www.3gre.cn, www.3grenn.cn, www.3gren.cn, www.3grenh.cn, www.3greh.cn, www.3grenj.cn, www.3grej.cn, www.3grenk.cn, www.3grek.cn, www.3grenl.cn, www.3grel.cn, www.3gren .cn, www.3gre .cn,

    Other websites we recently analyzed

    1. zyprian photographie | Das mobile Fotostudio – Events – Werbung – Hochzeiten
      Germany - 82.165.196.138
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Colorbox, Php, Pingback, Wordpress
      Number of Javascript: 5
      Number of meta tags: 3
    2. Trigrid Internship
      Scottsdale (United States) - 50.63.97.128
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 1
    3. christsmercychurch.com
      The official webpage of Christ's Mercy Church in Katy, Texas. Find out about who we are and what we do, as well as sermons and discipleship lessons.
      New York (United States) - 198.185.159.144
      Server software:
      Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
      Number of Javascript: 2
      Number of meta tags: 7
    4. smallkitchenappliancesreview.com
      Virgin Islands, British - 208.91.197.13
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    5. Bellingham Dental Group – Dentist in Bellingham, WA - Dentist Bellingham WA with Dr. Parker Haley
      Bellingham Dentist Dr. Parker Haley leads Bellingham Dental Group, offering a range of dental services including student & emergency services. 360-734-6190
      Scottsdale (United States) - 50.62.89.138
      G Analytics ID: UA-42878548-1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Google Font API, Html, Javascript, jQuery, jQuery Cycle, jQuery UI, Php, Pingback, Google Analytics, Wordpress, Google +1 Button
      Number of Javascript: 13
      Number of meta tags: 5
    6. Home
      My Joomla CMS
      Australia - 221.121.144.145
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, SuperFish, Joomla
      Number of Javascript: 15
      Number of meta tags: 3
    7. ylvx.net
      Ottawa (Canada) - 47.90.20.17
      Server software: Microsoft-IIS/7.5
      Technology: Html, Php
      Number of Javascript: 1
      Number of meta tags: 1
    8. beorc.com
      Wayne (United States) - 74.208.84.115
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    9. Changeist: Futures, Innovation, Strategic Design
      Changeist is a post-national research, consulting and creative group focused on strategic innovation for the future.
      New York (United States) - 198.49.23.145
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Google Analytics, Squarespace
      Number of Javascript: 2
      Number of meta tags: 7
    10. Susie Wong Bar & Restaurant - Windsor
      Susie Wong Bar & Restaurant - 12 Chapel St Windsor, VIC - 03 9510 1875 - OPENING HOURS Tue | Wed | Thur 6pm-late Fri | Sat | Sun 12-3pm & 6pm-late
      Adelaide (Australia) - 175.107.184.169
      Server software: Apache
      Technology: CSS, Html
      Number of Javascript: 4
      Number of meta tags: 3

    Check Other Websites